PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR03G02230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family GATA
Protein Properties Length: 314aa    MW: 33708.9 Da    PI: 6.8251
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR03G02230.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.52.1e-19212246135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C +C +t+Tp+WR gp+g++tLCnaCG++yr  g+
  LPERR03G02230.1 212 CGHCEATETPQWRAGPNGPSTLCNACGIRYRMDGR 246
                      9******************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011413.336206267IPR000679Zinc finger, GATA-type
SMARTSM004011.6E-17206257IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.47E-14209270No hitNo description
Gene3DG3DSA:3.30.50.102.7E-15210247IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.60E-14211260No hitNo description
PfamPF003204.5E-17212246IPR000679Zinc finger, GATA-type
PROSITE patternPS003440212237IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MSSYCVVPFD FLAGGDGNGG DDDDDMPCPT DGLCWPDDPI DEVMKCLSVI DEPLLHALKL  60
NCSPSLPPPA ADSGGGNTSR RESNAPAAND AQWFKASTAA RKPRNPPTIV NKRVWSMDRP  120
TLPVAVSNIR RELSSPCAAA VVADTVTIDN VHCESASPCA ATIVNTVVVV HDDDSHHREE  180
AFIGGGGGGG ENSRRPTAKR RRKRKCGEEK RCGHCEATET PQWRAGPNGP STLCNACGIR  240
YRMDGRLLPE YRPSTSPGFG SEEYSNRHRK VVKLREKKQK EGKVISGEAV MVPAMAAPNA  300
GEIMDQCAIV NISS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1198204KRRRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D9VP430.0A0A0D9VP43_9ORYZ; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP127772434
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.19e-25GATA transcription factor 1